Protein Info for BWI76_RS15165 in Klebsiella michiganensis M5al

Annotation: MBL fold metallo-hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 PF00753: Lactamase_B" amino acids 25 to 85 (61 residues), 52.2 bits, see alignment E=8e-18 PF12706: Lactamase_B_2" amino acids 37 to 96 (60 residues), 32.9 bits, see alignment E=4.9e-12

Best Hits

KEGG orthology group: K06897, (no description) (inferred from 68% identity to esc:Entcl_2253)

Predicted SEED Role

"STY3078 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B4C2 at UniProt or InterPro

Protein Sequence (266 amino acids)

>BWI76_RS15165 MBL fold metallo-hydrolase (Klebsiella michiganensis M5al)
MALIIKVLLENRLGEGQDSLLQAKPGLSLLVEDETSRVLFDTGPDGSFLHNAQRMGVSLS
DLTATVLSHGHYDHCGGVPWLPDNSRIICHPLIAQQRYSALSLAGRHWKVKKLSREIDYS
RHRMEYSREPLAIGERLLWSGEIAVARPRAYGVLAGQSPGEDYLADEGVLIYRSTRGLVI
ICGCGHRGLIDTIRHCQKITGVQQIRAIIGGLHLRSAPPWVIRRLKQFLRQQKVEEVMAC
HCTGSWGRWWLAADSAPATGDTLVLE