Protein Info for BWI76_RS15000 in Klebsiella michiganensis M5al

Annotation: amino acid ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 PF00005: ABC_tran" amino acids 17 to 168 (152 residues), 125.7 bits, see alignment E=4.4e-40 PF02463: SMC_N" amino acids 27 to 213 (187 residues), 42.7 bits, see alignment E=9.4e-15 PF13401: AAA_22" amino acids 27 to 187 (161 residues), 27.2 bits, see alignment E=8.9e-10 PF13304: AAA_21" amino acids 136 to 198 (63 residues), 30.4 bits, see alignment E=8.1e-11

Best Hits

Swiss-Prot: 56% identical to YXEO_BACSU: Probable amino-acid import ATP-binding protein YxeO (yxeO) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 93% identity to kva:Kvar_1429)

MetaCyc: 52% identical to cystine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-290 [EC: 7.4.2.12]; 7.4.2.12 [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]

Predicted SEED Role

"Cystine ABC transporter, ATP-binding protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B410 at UniProt or InterPro

Protein Sequence (246 amino acids)

>BWI76_RS15000 amino acid ABC transporter ATP-binding protein (Klebsiella michiganensis M5al)
MMTLNKISKSFSGESVLKEVSLSVNSGEIICIIGPSGSGKTTLLRTLNFLEPADSGKIKI
DDVALDCATAGKKEIEKLRGKTAMVFQSWNLFHNLTAVQNITEGLIYAKKRPRQEALNIA
ERLLKQVGLLHKKDHYPHSLSGGQKQRIGIARALAMSPAVLLLDEPTSALDPEKVGEVLE
LIQTIAAAGQTMIIVTHEMAFARQVASRVIFMENGEIVEQGPAEQIFGAAQQGRTRAFLA
QLHYHA