Protein Info for BWI76_RS14950 in Klebsiella michiganensis M5al

Annotation: glycosylasparaginase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 40% identical to ASPG_ELIMR: N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase from Elizabethkingia miricola

KEGG orthology group: None (inferred from 91% identity to enc:ECL_03784)

Predicted SEED Role

"L-asparaginase (EC 3.5.1.1)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 3.5.1.1)

MetaCyc Pathways

superpathway of L-aspartate and L-asparagine biosynthesis (4/4 steps found)
L-asparagine degradation I (1/1 steps found)
L-asparagine degradation III (mammalian) (2/3 steps found)
N-(1-deoxy-D-fructos-1-yl)-L-asparagine degradation (2/5 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.1

Use Curated BLAST to search for 3.5.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B400 at UniProt or InterPro

Protein Sequence (317 amino acids)

>BWI76_RS14950 glycosylasparaginase (Klebsiella michiganensis M5al)
MWGMIATWRMALEGVTEAATALASGADTASAVVNAVAAVEDFPLYKSVGYGGLPTENGEV
ELDAAFMDGDTLAFGAVGNLVDIANPVKVAHALSRQRYNSLLVGQGAREWAISQGFAAKS
MLTERAMQHYRKRCRETLDKGLSPYDGHDTVGIIGLDKQGSMSVATSTSGLFMKKRGRLG
DSPIIGSGFYCDSETGAATATGVGEDLMKGCASYEIVRRMAQGMTPQQAADSVVYELEDK
LMSRFGRAGDLSVVCMNRRGEFGAATNIKTFSFVVASATQPLTVFCAERVQEKTHYRPVD
DEWMQAYAARIRAPIEE