Protein Info for BWI76_RS14500 in Klebsiella michiganensis M5al

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 463 transmembrane" amino acids 26 to 44 (19 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 116 to 145 (30 residues), see Phobius details amino acids 158 to 181 (24 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details amino acids 260 to 284 (25 residues), see Phobius details amino acids 296 to 316 (21 residues), see Phobius details amino acids 327 to 344 (18 residues), see Phobius details amino acids 350 to 370 (21 residues), see Phobius details amino acids 380 to 401 (22 residues), see Phobius details amino acids 417 to 436 (20 residues), see Phobius details PF07690: MFS_1" amino acids 34 to 402 (369 residues), 172.7 bits, see alignment E=5.2e-55 TIGR00881: phosphoglycerate transporter family protein" amino acids 35 to 419 (385 residues), 488.6 bits, see alignment E=6.2e-151

Best Hits

Swiss-Prot: 92% identical to PGTP_SALTY: Phosphoglycerate transporter protein (pgtP) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K11382, MFS transporter, OPA family, phosphoglycerate transporter protein (inferred from 95% identity to kpu:KP1_2767)

Predicted SEED Role

"Phosphoglycerate transporter protein PgtP"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3Z2 at UniProt or InterPro

Protein Sequence (463 amino acids)

>BWI76_RS14500 MFS transporter (Klebsiella michiganensis M5al)
MLSILKKGPSANKVPAEKVQATYGRYRIQALLSVFLGYLAYYIVRNNFTLSTPYLKEQLD
LSATQIGLLSSCMLIAYGISKGIMSSLADKASPKVFMTCGLVLCAIVNVGLGFSTAFWIF
AALVVLNGLFQGMGVGPSFITIANWFPRRERGRVGAFWNISHNVGGGIVAPIVGAAFAIL
GSEHWQSASYIVPACVAVVFALSVLALGKGSPREEGLPALEEMMPEEKVVLNAKHAVKAP
ENMSALQIFCTYVLRNKNAWYVSFVDVFVYMVRFGMISWLPIYLLTVKHFSKEQMSVAFL
FFEWAAIPSTLLAGWLSDKLFKGRRMPLAMICMALIFICLIGYWKSESLLMVTVFAAIVG
CLIYVPQFLASVQTMEIVPSFAVGSAVGLRGFMSYIFGASLGTSLFGVMVDKMGWHGGFY
LLMGGIVCCILFCYLSHRGALELEQQRKNTLQQEAELALADAR