Protein Info for BWI76_RS14480 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 PF00072: Response_reg" amino acids 8 to 117 (110 residues), 104.5 bits, see alignment E=9e-34 PF00158: Sigma54_activat" amino acids 142 to 202 (61 residues), 29.2 bits, see alignment E=1.8e-10 PF14532: Sigma54_activ_2" amino acids 143 to 278 (136 residues), 55.5 bits, see alignment E=2e-18 PF25601: AAA_lid_14" amino acids 285 to 339 (55 residues), 38.9 bits, see alignment 1.5e-13 PF02954: HTH_8" amino acids 366 to 406 (41 residues), 38.4 bits, see alignment 2e-13

Best Hits

Swiss-Prot: 80% identical to PGTA_SALTY: Phosphoglycerate transport system transcriptional regulatory protein PgtA (pgtA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K08476, two-component system, NtrC family, phosphoglycerate transport system response regulator PgtA (inferred from 90% identity to kpn:KPN_01721)

Predicted SEED Role

"Phosphoglycerate transport system transcriptional regulatory protein PgtA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B405 at UniProt or InterPro

Protein Sequence (416 amino acids)

>BWI76_RS14480 hypothetical protein (Klebsiella michiganensis M5al)
MLSNECSILLIDDDADVLDAYTQLLEQAGYHVHACDNPFAAREWVQKDWPGIVLSDVCMP
GCSGIDLMTLFHQDDEQLPIVLITGHGDVPMAVDAVKKGAWDFLQKPVDPGKLLSLVDAA
LRQRQSVIARRQYGQQTLRVELVGRSQWLEQYRQRLQQLAETDIAVWLYGEPGTGRMTGA
RYLHQLGHNADGPFIYCELTPANAHKLNEPIAQAQGGTLVLSHPEHLTHEQQHQLVQSQS
LERRPFRLIGIGNASLVELAASGRIVAELYYCFAMTQIACLPLSKRPDDIEPLFHHYLQK
TCQRLNHPVPEVDSHLLKGMMRRVWLNNVRELANAAELFAVGVLPLADTVNPQMHVGEPT
PLDRRVEDVERQIITEALNIHQGRINEVAEYLLIPRKKLYLRMKKYGLSKEHYKGF