Protein Info for BWI76_RS14220 in Klebsiella michiganensis M5al
Annotation: hypothetical protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 49% identical to Y1053_HAEIN: Uncharacterized protein HI_1053 (HI_1053) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)
KEGG orthology group: None (inferred from 67% identity to bur:Bcep18194_A3878)Predicted SEED Role
"Possible carboxymuconolactone decarboxylase family protein (EC 4.1.1.44)" (EC 4.1.1.44)
MetaCyc Pathways
- aromatic compounds degradation via β-ketoadipate (9/9 steps found)
- protocatechuate degradation II (ortho-cleavage pathway) (4/4 steps found)
- toluene degradation III (aerobic) (via p-cresol) (7/11 steps found)
- superpathway of aromatic compound degradation via 3-oxoadipate (23/35 steps found)
- superpathway of aerobic toluene degradation (15/30 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 4.1.1.44
Use Curated BLAST to search for 4.1.1.44
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (113 amino acids)
>BWI76_RS14220 hypothetical protein (Klebsiella michiganensis M5al) MFLNWTEMRKEIRAAIGKFAGLQPDVMQGIDKMQNGAAATGHLDAKTHELIALAVAVTTR CDGCLSVHAEAAAKHGATREEIAEALGVAITLNTGAALVYSSRALDAFDSLPK