Protein Info for BWI76_RS14220 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 113 PF02627: CMD" amino acids 24 to 106 (83 residues), 77.1 bits, see alignment E=4.3e-26 TIGR00778: alkylhydroperoxidase AhpD family core domain" amino acids 41 to 90 (50 residues), 64.7 bits, see alignment E=2.1e-22

Best Hits

Swiss-Prot: 49% identical to Y1053_HAEIN: Uncharacterized protein HI_1053 (HI_1053) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 67% identity to bur:Bcep18194_A3878)

Predicted SEED Role

"Possible carboxymuconolactone decarboxylase family protein (EC 4.1.1.44)" (EC 4.1.1.44)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.44

Use Curated BLAST to search for 4.1.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (113 amino acids)

>BWI76_RS14220 hypothetical protein (Klebsiella michiganensis M5al)
MFLNWTEMRKEIRAAIGKFAGLQPDVMQGIDKMQNGAAATGHLDAKTHELIALAVAVTTR
CDGCLSVHAEAAAKHGATREEIAEALGVAITLNTGAALVYSSRALDAFDSLPK