Protein Info for BWI76_RS13920 in Klebsiella michiganensis M5al

Annotation: magnesium-translocating P-type ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 910 transmembrane" amino acids 87 to 105 (19 residues), see Phobius details amino acids 117 to 134 (18 residues), see Phobius details amino acids 296 to 316 (21 residues), see Phobius details amino acids 327 to 350 (24 residues), see Phobius details amino acids 710 to 733 (24 residues), see Phobius details amino acids 737 to 757 (21 residues), see Phobius details amino acids 779 to 802 (24 residues), see Phobius details amino acids 813 to 832 (20 residues), see Phobius details amino acids 844 to 864 (21 residues), see Phobius details amino acids 879 to 897 (19 residues), see Phobius details TIGR01524: magnesium-translocating P-type ATPase" amino acids 18 to 909 (892 residues), 1577.4 bits, see alignment E=0 PF00690: Cation_ATPase_N" amino acids 34 to 98 (65 residues), 60.5 bits, see alignment 2.5e-20 PF00122: E1-E2_ATPase" amino acids 149 to 359 (211 residues), 133.5 bits, see alignment E=1.6e-42 TIGR01494: HAD ATPase, P-type, family IC" amino acids 275 to 400 (126 residues), 67.6 bits, see alignment E=7.3e-23 amino acids 624 to 739 (116 residues), 98.9 bits, see alignment E=2.4e-32 PF00702: Hydrolase" amino acids 375 to 664 (290 residues), 54.9 bits, see alignment E=4e-18 PF00689: Cation_ATPase_C" amino acids 733 to 901 (169 residues), 79.7 bits, see alignment E=6.1e-26

Best Hits

Swiss-Prot: 89% identical to ATMB_SALTY: Magnesium-transporting ATPase, P-type 1 (mgtB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01531, Mg2+-importing ATPase [EC: 3.6.3.2] (inferred from 89% identity to esc:Entcl_1059)

Predicted SEED Role

"Mg(2+) transport ATPase, P-type (EC 3.6.3.2)" (EC 3.6.3.2)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.2

Use Curated BLAST to search for 3.6.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3Q3 at UniProt or InterPro

Protein Sequence (910 amino acids)

>BWI76_RS13920 magnesium-translocating P-type ATPase (Klebsiella michiganensis M5al)
MTDMKIENRKLNRSASENDKQHKKSFAIETEAFNSPDHTLARLNSSRQGLTTEDALERLD
EYGRNEVAHEQAPPALIQLLQAFNNPFIYVLMALAAVSFVTDYWLPLRNGEETDLTGIII
IVTMVSLSGLLRFWQEFRTNKAAQALKSMVRTTATVLRRGPGNMGPTQEEIAIEELVPGD
IIFLAAGDLVPADVRLLESRDLFVSQSILSGESLPVEKYDVLASVSGKGCDRLPEPNKDK
SLLEMGNICLMGTNVTSGRAQAVVVATGNRTWFGSLAKSIVGTRTQTAFDRGVNSVSWLL
IRFMLVMVPIVLLINGFSKGDWVEASLFALAVAVGLTPEMLPMIVSSNLAKGAIAMSRRK
VIVKRLNAIQNFGAMDVLCTDKTGTLTQDNIILEHHLDVSGSESDRVLTLSWLNSSSQSG
ARNLMDRAVLRFGEGRIAPATKERFVKLDELPFDFVRRRVSVSVEDVRHGDKSLICKGAV
EEMLTVATHLREGDRVVALDDTRRDLLLAKTQDYNAQGFRVLLVATRKLDDSALTAPLCA
DDEQGLTVEGMLTFLDPPKESAGKAITALRDNGVAVKVLTGDNPVVTARICLEVGIDAHG
ILTGPQIEAMTDNELEREVETRAVFAKLTPLQKSRILKTLQKNGHTVGFLGDGINDAPAL
RDADVGISVDSAADIAKEASDIILLEKDLMVLEEGVIKGRETFGNIIKYLNMTASSNFGN
VFSVLVASAFIPFLPMLAIHLLIQNLMYDLSQLSLPWDKMDKEFLRKPRKWDAKNIGRFM
LWIGPTSSIFDITTFALMWYVFAANNVEAQALFQSGWFIEGLLSQTLVVHMLRTQKIPFI
QSRATLPVLLTTALIMAMGIYIPFSPLGAMVGLEPLPLSYFPWLVATLLSYCVVAQGMKR
FYIKRFGQWF