Protein Info for BWI76_RS13705 in Klebsiella michiganensis M5al

Annotation: Rieske (2Fe-2S) domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 PF00355: Rieske" amino acids 49 to 130 (82 residues), 61.1 bits, see alignment E=8e-21 PF00848: Ring_hydroxyl_A" amino acids 200 to 403 (204 residues), 56.6 bits, see alignment E=3.5e-19

Best Hits

Swiss-Prot: 60% identical to CBDA_BURCE: 2-halobenzoate 1,2-dioxygenase large subunit (cbdA) from Burkholderia cepacia

KEGG orthology group: K05549, benzoate 1,2-dioxygenase alpha subunit [EC: 1.14.12.10] (inferred from 93% identity to kpe:KPK_2484)

MetaCyc: 60% identical to 2-halobenzoate 1,2-dioxygenase large subunit (Burkholderia cepacia 2CBS)

Predicted SEED Role

"Benzoate 1,2-dioxygenase alpha subunit (EC 1.14.12.10)" in subsystem Benzoate degradation (EC 1.14.12.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.10

Use Curated BLAST to search for 1.14.12.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3Q5 at UniProt or InterPro

Protein Sequence (460 amino acids)

>BWI76_RS13705 Rieske (2Fe-2S) domain-containing protein (Klebsiella michiganensis M5al)
MQKTFARLKDKISNALIVDREKHIYRCHRSIFTDPQLFDFEMKHIFEGNWLFLAHESQIA
QPGDYYTLTLGRQPVIITRDKKNELHALINSCAHRGAMLCRRKTGNKNSLTCPFHGWTFS
NNGKLLKAKDESTGGYPDSFKQEGSHDLTKLPKFQSYRGFLFGSLNADVQPLEEYLGETR
KIIDLIVDQAPQGLEVLKGSSSYVYEGNWKLGAENGADGYHVSVVHWNYASTMSRRNYEA
EGTHAVDANGWSKSVGGGYGFENGHMLLWTRALNPEVRPVYEHRERLRAEFGESRADRMV
NETRNLCLYPNVYLMDQFSTQIRVIRPIAVDKTEVTIWCFAPRGESDQARALRIRQYEDF
FNVSGMGTPDDLEEFSACQRGYLGENLAWSDLSRGALHWVDGPDDHALQAGFSPQLSGVK
SEDEALYIAHHHHWQNVMLAALETERQRYDQSITQRVEVA