Protein Info for BWI76_RS13680 in Klebsiella michiganensis M5al

Annotation: methyl viologen resistance protein SmvA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 496 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 43 to 64 (22 residues), see Phobius details amino acids 73 to 91 (19 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details amino acids 159 to 181 (23 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details amino acids 221 to 240 (20 residues), see Phobius details amino acids 260 to 281 (22 residues), see Phobius details amino acids 298 to 319 (22 residues), see Phobius details amino acids 327 to 345 (19 residues), see Phobius details amino acids 355 to 379 (25 residues), see Phobius details amino acids 393 to 412 (20 residues), see Phobius details amino acids 464 to 486 (23 residues), see Phobius details PF07690: MFS_1" amino acids 12 to 403 (392 residues), 130.8 bits, see alignment E=3e-42

Best Hits

Swiss-Prot: 75% identical to SMVA_SALTY: Methyl viologen resistance protein SmvA (smvA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K08167, MFS transporter, DHA2 family, methyl viologen resistance protein SmvA (inferred from 89% identity to kpu:KP1_2943)

Predicted SEED Role

"Methyl viologen resistance protein smvA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3U8 at UniProt or InterPro

Protein Sequence (496 amino acids)

>BWI76_RS13680 methyl viologen resistance protein SmvA (Klebsiella michiganensis M5al)
MSRQWLTLMAILLVYIPVAIDATVLHVAAPTLSVALGTSGNELLWIIDIYSLVMAGMVLP
MGALGDKIGFKRLLLLGSGIFGSASLAAAFSPTAETLIASRALLAVGAAMIVPATLAGIR
STFSQAQQRNMALGLWAAVGSGGAAFGPLIGGMLLEHFYWGSVFRINVPIVLLVMAINAK
VVPRQPARREQPLNFFQALILIAAILMLVFSAKTALKGQMALWLTGLVAVSGAAMLFWFV
RKQLSATRPMVDMRLFTHRIILSGVMMAMTALITLVGFELLMAQELQFVHSKTPFEAGLF
MLPVMVASGFSGPIAGMLVSRLGLREVATGGMLLSALSFLGLSMTDFSTQQWQAWGLMTL
LGFSVASALLASSSAIMAAAPKEKAAAAGAIETMAYELGAGLGIALFGLILTRSYTSSIV
LPQGIEGAAAEQASSSISEAIKLAQSLPAIPAQSLLEAAKAAFIHSHSTVLATAGVLLLL
LAAGIWRSLAKAPELN