Protein Info for BWI76_RS13530 in Klebsiella michiganensis M5al

Annotation: amidohydrolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 TIGR01891: amidohydrolase" amino acids 7 to 356 (350 residues), 367.2 bits, see alignment E=4.7e-114 PF01546: Peptidase_M20" amino acids 63 to 367 (305 residues), 131.2 bits, see alignment E=5.1e-42 PF07687: M20_dimer" amino acids 176 to 266 (91 residues), 45.4 bits, see alignment E=6.8e-16

Best Hits

Swiss-Prot: 48% identical to YXEP_BACSU: Uncharacterized hydrolase YxeP (yxeP) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 90% identity to kpn:KPN_01902)

MetaCyc: 48% identical to N-acetyl-sulfur-metabolite deacetylase (Bacillus subtilis subtilis 168)
3.5.1.-

Predicted SEED Role

"N-acetyl-L,L-diaminopimelate deacetylase homolog (EC 3.5.1.18)" (EC 3.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.18

Use Curated BLAST to search for 3.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3M4 at UniProt or InterPro

Protein Sequence (373 amino acids)

>BWI76_RS13530 amidohydrolase family protein (Klebsiella michiganensis M5al)
MSLAEQLIRWRRELHQYPELSLQEVDTTARIRDWLQSGGISLLPYDLKTGAVAEVGSGNK
VIALRADIDALPIEEAASVPFRSLNAGVMHACGHDIHTSVILGAALLLKQREAQLAGRVR
ILFQPAEESFGGAKTLIRAGVLEGVSAIFGMHNEPGLPVGEFATRGGAFYANVDRFVFKV
TGKGAHAARPHEGKDAILLASQLVTLLQSVASREVNTLDSVVLSVTRIQGGNTWNVLPES
VELEGTLRTHSSEVQQRVKARVSEIAAGFASAFGAQIDVFWYAGPTALVNDERWAAFASD
VADKSGYRTHHADLHLGGEDFAVYLQHIPGAFVSIGSASEFGLHHPAFNPDERLIAPAAH
YFADLAEQALKEL