Protein Info for BWI76_RS13510 in Klebsiella michiganensis M5al

Annotation: YgdI/YgdR family lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 73 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF06004: DUF903" amino acids 23 to 71 (49 residues), 83.2 bits, see alignment E=4.7e-28

Best Hits

Swiss-Prot: 49% identical to YGDR_ECOL6: Uncharacterized lipoprotein YgdR (ygdR) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 90% identity to kva:Kvar_2398)

Predicted SEED Role

"Putative outer membrane lipoprotein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3L0 at UniProt or InterPro

Protein Sequence (73 amino acids)

>BWI76_RS13510 YgdI/YgdR family lipoprotein (Klebsiella michiganensis M5al)
MKKSFMVVCAGAMLALLAGCSSNYVMTTKSGQTIVTQGKPQLDKDTGMTSYTDESGNKRQ
INSSDVAQLVEDN