Protein Info for BWI76_RS13355 in Klebsiella michiganensis M5al

Annotation: AraC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 PF00165: HTH_AraC" amino acids 194 to 234 (41 residues), 37.5 bits, see alignment 2e-13 amino acids 247 to 284 (38 residues), 35.6 bits, see alignment 7.9e-13 PF12833: HTH_18" amino acids 207 to 285 (79 residues), 78.4 bits, see alignment E=4e-26

Best Hits

KEGG orthology group: None (inferred from 90% identity to eae:EAE_20195)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3B8 at UniProt or InterPro

Protein Sequence (288 amino acids)

>BWI76_RS13355 AraC family transcriptional regulator (Klebsiella michiganensis M5al)
MAYGTFETLRQKNAVLRETVKLNSGIQLAAWYNNLDTITVQSDHHTLSLYIADGYESYQK
TPHGWKNGGGPDRFCLMPKGDESTWDIRGDLSFVHLYCTDEHLRRVGEQIWDRSPASFTL
QEKTFSSDDKITAVYRQFLLDNDWQQQANQLTLSSASTLLLTHLIQHYSNVQWRLPTVTG
GLAPHVLRNLLAWIEEHLDRPLTLADLAQEAALSEYHFARMFRQSMKMAPHQYVMQRRMV
KAQELIYCSQMSLTDIAMACGFSTASHFSNRVKSATGLTPSQLRAAQR