Protein Info for BWI76_RS13315 in Klebsiella michiganensis M5al

Annotation: 50S ribosomal protein L7/L12-serine acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 194 PF13302: Acetyltransf_3" amino acids 18 to 158 (141 residues), 67.5 bits, see alignment E=3e-22 PF13420: Acetyltransf_4" amino acids 29 to 177 (149 residues), 38 bits, see alignment E=2.6e-13 PF00583: Acetyltransf_1" amino acids 53 to 157 (105 residues), 46.5 bits, see alignment E=6.2e-16

Best Hits

Swiss-Prot: 68% identical to RIML_ECOLI: Ribosomal-protein-serine acetyltransferase (rimL) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 80% identity to eae:EAE_20235)

MetaCyc: 68% identical to ribosomal-protein-L12-serine N-acetyltransferase (Escherichia coli K-12 substr. MG1655)
2.3.1.-

Predicted SEED Role

"Ribosomal-protein-L7p-serine acetyltransferase" in subsystem Ribosome biogenesis bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3G9 at UniProt or InterPro

Protein Sequence (194 amino acids)

>BWI76_RS13315 50S ribosomal protein L7/L12-serine acetyltransferase (Klebsiella michiganensis M5al)
MSAENTASIERIPVTASLSLRAVDERYVTELHQLVMKNQRWLQQSLSWPADVSHEDETRR
HVQGNVMLHQRGYAKMFLLFLQEEIVGVLSFNQIEPINKTAYIGYWIDESHQGQGLLSQA
LQALMDSFARSGTVRRFVIKCRVANQRSNQVALRNGFTLEGCLKQAEYLNGSYDDQNIYG
RIIDCRSEQFPGRG