Protein Info for BWI76_RS13230 in Klebsiella michiganensis M5al

Annotation: GGDEF domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 PF01590: GAF" amino acids 28 to 154 (127 residues), 48.9 bits, see alignment E=1.5e-16 PF13185: GAF_2" amino acids 28 to 154 (127 residues), 37.8 bits, see alignment E=3.2e-13 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 163 to 317 (155 residues), 143.5 bits, see alignment E=2.5e-46 PF00990: GGDEF" amino acids 164 to 318 (155 residues), 144.6 bits, see alignment E=3.6e-46

Best Hits

KEGG orthology group: None (inferred from 83% identity to kpu:KP1_3652)

Predicted SEED Role

"FOG: GGDEF domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B364 at UniProt or InterPro

Protein Sequence (323 amino acids)

>BWI76_RS13230 GGDEF domain-containing protein (Klebsiella michiganensis M5al)
MKLAGLHPDELRRLQSLRTSGLLNSGKEERFDRLTRLARTLYDLPVASISLVGENTLHVK
SCAGLEVDTLPRDITFCAHTILQTDPLIVNDLQQDLRFHDNPLVTEAPFIRFYAGYPVQL
PDGATVGAFCLMDHKPRAFSVHEIQILSDLAAIVEDEFKVLDAATADELTGLFNRRGFMS
LAEYALLTARRRNEPASLIFIDLDRFKLINDTWGHEQGDKALRAIADLMKATFRESDLIA
RQGGDEFIILLANTSQQTAGLAMEQLSKNVAEYNQQAGNPWQLAFSWGCVEYDPAAHHSL
NEIVAVADRRMYQAKSSHGAERR