Protein Info for BWI76_RS13215 in Klebsiella michiganensis M5al

Annotation: type I glyceraldehyde-3-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 TIGR01534: glyceraldehyde-3-phosphate dehydrogenase, type I" amino acids 3 to 325 (323 residues), 441.7 bits, see alignment E=8.6e-137 PF00044: Gp_dh_N" amino acids 3 to 102 (100 residues), 117 bits, see alignment E=4.1e-38 PF02800: Gp_dh_C" amino acids 155 to 313 (159 residues), 198.9 bits, see alignment E=3.9e-63

Best Hits

Swiss-Prot: 88% identical to G3P2_ECO57: Glyceraldehyde-3-phosphate dehydrogenase C (gapC) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 93% identity to eae:EAE_20370)

MetaCyc: 64% identical to glyceraldehyde-3-phosphate dehydrogenase subunit (Lactobacillus delbrueckii bulgaricus)
Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating). [EC: 1.2.1.12]

Predicted SEED Role

"NAD-dependent glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.12)" in subsystem Calvin-Benson cycle or Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Pyridoxin (Vitamin B6) Biosynthesis or Redox-dependent regulation of nucleus processes (EC 1.2.1.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.12

Use Curated BLAST to search for 1.2.1.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3E9 at UniProt or InterPro

Protein Sequence (332 amino acids)

>BWI76_RS13215 type I glyceraldehyde-3-phosphate dehydrogenase (Klebsiella michiganensis M5al)
MSKLGINGFGRIGRLVLRRLLEVDSPLEVVAINDLTSPKVLAYLLKHDSNYGPFPWSVDF
TEDALIVDGKKITVYAEKEAQHIPWKAVSAELIVECTGFYTSAEKAQAHLTAGAKKVLIS
APAGDMKTIVYNVNDDTLDANDTIISVASCTTNCLAPMAKVLHDAFGIKVGTMTTIHAYT
GTQSLVDGPRGKDLRASRAAAENIIPHTTGAAKAIGLVIPELSGKLKGHAQRVPTKTGSV
TELVSVLEKKVSAEEVNQAMKNAAANNESFGYTEEEIVSSDVIGSHFGSIYDATQLEIAE
VGDLQLVKTVAWYDNEYGFVTQLIRVLDKFAK