Protein Info for BWI76_RS13175 in Klebsiella michiganensis M5al

Annotation: NodT family RND efflux system outer membrane lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 9 to 452 (444 residues), 355 bits, see alignment E=3.2e-110 PF02321: OEP" amino acids 60 to 244 (185 residues), 74.4 bits, see alignment E=5.2e-25 amino acids 265 to 450 (186 residues), 78.3 bits, see alignment E=3.4e-26

Best Hits

KEGG orthology group: None (inferred from 91% identity to kpu:KP1_2489)

Predicted SEED Role

"FIG00732044: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B354 at UniProt or InterPro

Protein Sequence (459 amino acids)

>BWI76_RS13175 NodT family RND efflux system outer membrane lipoprotein (Klebsiella michiganensis M5al)
MIRPLALAVILALAGCQSADVQQAAPGLQIPAAWRADVGPSSPVEGVWWRNFHDSTLNLY
VDQALRYNSDVLMARERVNEYQARAYAADSSLFPSLDAGLTGTRARSQSAATGLPVHSTV
YKGALTASYDVDIWGANRSASSAAQASLEAQKAAAAAANLTVASSVAVGYITLLSLDEQL
RVTQQTLKSREDAFNLAKRQFETGYTSRLELMQADSELRSTRAQIPPLRHQIAQQENALS
LLLGANPGAVKRNAFAQLSPLSLPSQLPSTLLNRRPDIVQAQRQLVAADATLASSQAQLL
PSINLTATGSLQDRTLPDLLDNPLRLWSLGGSILAPLLNRQALNAQVDVSMAQRNQALYS
YEKTVRGALKEVNDSLDAIGRYGEQLSELQAQEKVAQETLRIAQNRYRNGYSSYLDVLDA
QRTLFSTQLSVVQVKNNLLLAQVDLYRSLGGGWSDSSGT