Protein Info for BWI76_RS13100 in Klebsiella michiganensis M5al

Annotation: phenylacetate-CoA oxygenase subunit PaaI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF05138: PaaA_PaaC" amino acids 4 to 251 (248 residues), 318.6 bits, see alignment E=1.4e-99 TIGR02158: phenylacetate-CoA oxygenase, PaaI subunit" amino acids 14 to 251 (238 residues), 332.7 bits, see alignment E=7.4e-104

Best Hits

Swiss-Prot: 74% identical to PAAC_ECOLI: 1,2-phenylacetyl-CoA epoxidase, subunit C (paaC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 84% identity to eae:EAE_20510)

MetaCyc: 74% identical to phenylacetyl-CoA 1,2-epoxidase, structural subunit (Escherichia coli K-12 substr. MG1655)
RXN0-2042 [EC: 1.14.13.149]

Predicted SEED Role

"Phenylacetate-CoA oxygenase, PaaI subunit"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.149

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3C8 at UniProt or InterPro

Protein Sequence (251 amino acids)

>BWI76_RS13100 phenylacetate-CoA oxygenase subunit PaaI (Klebsiella michiganensis M5al)
MNNDNPVAAYALRLGDNGLVLAQRLGEWCGHAPELEIDLALANIGLDLLGQARNFLSYAA
ELAGSGDEDTLAFGRNERQFCNLLLAEQPNGNFADTLARQFFIDVWHVALYGRLVSSRDT
QLAAIAAKALKEVRYHQRFSRGWLERLGNGTALSAQRMQDAVDNLWRFTGELFQADALEI
ELSAQGIAVDPRELQAEWQATVRAALSDAGLQIPEEAPFRHGGKQGLHSEHLGPLLAEMQ
YLQRAYPGQRW