Protein Info for BWI76_RS12935 in Klebsiella michiganensis M5al

Annotation: fusaric acid resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 679 transmembrane" amino acids 35 to 69 (35 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 105 to 125 (21 residues), see Phobius details amino acids 132 to 150 (19 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 383 to 401 (19 residues), see Phobius details amino acids 407 to 424 (18 residues), see Phobius details amino acids 431 to 453 (23 residues), see Phobius details amino acids 459 to 476 (18 residues), see Phobius details amino acids 483 to 503 (21 residues), see Phobius details amino acids 513 to 534 (22 residues), see Phobius details PF04632: FUSC" amino acids 34 to 672 (639 residues), 514.8 bits, see alignment E=8.7e-158 PF06081: ArAE_1" amino acids 43 to 180 (138 residues), 29.2 bits, see alignment E=1.8e-10 PF13515: FUSC_2" amino acids 46 to 177 (132 residues), 57.7 bits, see alignment E=2.8e-19 PF11744: ALMT" amino acids 60 to 183 (124 residues), 26 bits, see alignment E=9.2e-10

Best Hits

KEGG orthology group: None (inferred from 73% identity to kpe:KPK_B0022)

Predicted SEED Role

"COG1289: Predicted membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B3F1 at UniProt or InterPro

Protein Sequence (679 amino acids)

>BWI76_RS12935 fusaric acid resistance protein (Klebsiella michiganensis M5al)
MNKLTSPHSHFLHAISRWPGRMATPALLSDAHALLYSVRSFAAAMLAYYLALAIGLERPS
WAIITVYIVSQTSVGASLSRSLYRLAGTVAGAGATVLIVPTFVNTPILCSVMLTGWITFC
LYLSLLERTPRAYAFVLAGYTASLIGFPAVADPGTVFNIAIIRVQEIAIGIVCAALIHRY
ILPTRISGVFNSKLAQTLGAARQRIADTLAGKSDAQSEPLHLALALQFLQGISHHIPYDF
ALSVPVRQARKALHDRLARLVIVNVELRDRLQAIALMPADTRTLLNDVQAWLTCDDSGKC
NSAADALQQRGARLAQRYAAQALTFEDALQVNFLRYLAESIALLQQCGRLSEAIHHARPA
TMQAEDRAAKGYVFHRDPLSAARTALGAFVIILSGCLAWIYSAWPDGGTAVSILGVCCTL
FGSFDTPAPHIVKYIIGSFWGVVISLLYSFALLPPLSDFPVLAAVLAPAYLLAGSLQARP
PTTFMAMGITLTLPVLCELGARYSGDFAEAANTAIALFLATGFAVIGMSLLQTVQADAAI
NRLLKLCQRDIRRSVNDAFRGDETHWTNLMIDRAALLLPRLPRSGRSSARALEHLLRFLR
LGLCVMRLRRCETPAGSDIHEVLYPLTRTTETEALRKRIAAMTERCLPATDEHSRQFIDR
LVDLHCALRTQNEEPTHDQ