Protein Info for BWI76_RS12910 in Klebsiella michiganensis M5al

Annotation: 3,4-dihydroxyphenylacetate 2,3-dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00903: Glyoxalase
  • amino acids 20 to 123 (104 residues), 35.2 bits, E=7.2e-13

Predicted SEED Role

"Catechol 2,3-dioxygenase (EC 1.13.11.2)" in subsystem Central meta-cleavage pathway of aromatic compound degradation (EC 1.13.11.2)

MetaCyc Pathways

• mandelate degradation to acetyl-CoA (14/18 steps found)
• catechol degradation I (meta-cleavage pathway) (4/5 steps found)
• catechol degradation to 2-hydroxypentadienoate I (1/2 steps found)
• catechol degradation II (meta-cleavage pathway) (4/7 steps found)
• toluene degradation I (aerobic) (via o-cresol) (4/7 steps found)
• toluene degradation V (aerobic) (via toluene-cis-diol) (4/7 steps found)
• 2-nitrotoluene degradation (1/3 steps found)
• meta cleavage pathway of aromatic compounds (6/10 steps found)
• catechol degradation to 2-hydroxypentadienoate II (1/4 steps found)
• toluene degradation to 2-hydroxypentadienoate (via toluene-cis-diol) (1/4 steps found)
• toluene degradation to 2-hydroxypentadienoate I (via o-cresol) (1/4 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (23/35 steps found)
• toluene degradation II (aerobic) (via 4-methylcatechol) (2/6 steps found)
• toluene degradation IV (aerobic) (via catechol) (7/13 steps found)
• naphthalene degradation to acetyl-CoA (5/12 steps found)
• superpathway of aerobic toluene degradation (15/30 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (17/42 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Benzoate degradation via hydroxylation
• Carbazole degradation
• Styrene degradation
• Toluene and xylene degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.2

Protein Sequence (268 amino acids)

>BWI76_RS12910 3,4-dihydroxyphenylacetate 2,3-dioxygenase (Klebsiella michiganensis M5al)
MTIENVIATVPAPDILRCAYMEIQVTDLRAAREFYVDILGLTVTAEDDQHIYLRSIEEFI
HHNLVLRQGPIAAMTAFSFRMRSREDVDRAEAWFRARGCRKEGFTRGIGDSVRVEDPLGF
PHEFFHDVQNVERLTWRYDLHTPGALRKSDLIERGPGRHGVSNAFYLYLRDPDGHRIEIY
TQDYYTGDPDNPVMSWDVDDNQRRDWWGNPVAASWYTEGSLVLDLDGNPQPVTERSEPSE
MAVTIGADGFSYTRKDDVLEGFRLGNSL