Protein Info for BWI76_RS12725 in Klebsiella michiganensis M5al

Annotation: outer membrane pore protein N, non-specific

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13609: Porin_4" amino acids 12 to 352 (341 residues), 85.9 bits, see alignment E=4.5e-28 PF00267: Porin_1" amino acids 27 to 382 (356 residues), 495 bits, see alignment E=1.4e-152

Best Hits

Swiss-Prot: 82% identical to OMPN_ECOLI: Outer membrane porin N (ompN) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 84% identity to eae:EAE_20595)

MetaCyc: 82% identical to outer membrane porin N (Escherichia coli K-12 substr. MG1655)
RXN0-2481

Predicted SEED Role

"Outer membrane protein N precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B308 at UniProt or InterPro

Protein Sequence (382 amino acids)

>BWI76_RS12725 outer membrane pore protein N, non-specific (Klebsiella michiganensis M5al)
MKRKVLALVIPALLAAGAAHSAEIYNKDGNKLDLYGKVDGLHYFSDDSSKDGDQSYVRLG
FKGETQINDQLTGYGQWEYNVQANNTEGSDNQAWTRLAFAGLKFANYGSFDYGRNYGVLY
DVEGWTDMLPEFGGDSYTQADNFMTGRANGVATYRNNDFFGLVNGLNFALQYQGKNENQS
GDENQEGTANNNGRNVKNSNGDGFGLSSSYDLGMGVSIAAAYSSSDRTNEQTHYSTAGGD
KADAWTAGLKYDANNIYLATMYSETRNMTPYGNNSDTIANKTQNFEVTAQYQFDFGLRPA
ISYLQSKGKDLVMQGNAANPAGNTGDKDLVKYVDIGATYYFNRNMSTYVDYKINLLDEDD
SFYSNNGISTDDVVALGLVYQF