Protein Info for BWI76_RS12705 in Klebsiella michiganensis M5al

Annotation: ATP-dependent RNA helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 PF04851: ResIII" amino acids 25 to 187 (163 residues), 32.4 bits, see alignment E=1.7e-11 PF00270: DEAD" amino acids 27 to 192 (166 residues), 163.7 bits, see alignment E=6.9e-52 PF00271: Helicase_C" amino acids 228 to 336 (109 residues), 105.2 bits, see alignment E=4.8e-34 PF03880: DbpA" amino acids 384 to 454 (71 residues), 71.5 bits, see alignment E=9.8e-24

Best Hits

Swiss-Prot: 89% identical to DBPA_ECOLI: ATP-dependent RNA helicase DbpA (dbpA) from Escherichia coli (strain K12)

KEGG orthology group: K05591, ATP-independent RNA helicase DbpA [EC: 3.6.4.13] (inferred from 92% identity to cko:CKO_01417)

MetaCyc: 89% identical to ATP-dependent RNA helicase DbpA (Escherichia coli K-12 substr. MG1655)
5.6.2.e [EC: 5.6.2.e]

Predicted SEED Role

"ATP-dependent 23S rRNA helicase DbpA"

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.13

Use Curated BLAST to search for 3.6.4.13 or 5.6.2.e

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B362 at UniProt or InterPro

Protein Sequence (457 amino acids)

>BWI76_RS12705 ATP-dependent RNA helicase (Klebsiella michiganensis M5al)
MTAFSTLNVLPAAQLTNLNELGYLSMTPVQAAALPAILAGKDVRVQAKTGSGKTAAFGLG
LLQHVDASLFQTQSLVLCPTRELADQVAGELRRLARFLANIKILTLCGGQPFGAQRDSLQ
HAPHIIVATPGRLLDHLQKGTVSLDALQTLVMDEADRMLDMGFSDAIDEVIRFAPASRQT
LLFSATWPEAIAAISGRVQNNPQTIEIDAVDALPAIEQQFFETSQHGKITLLQKLLSQHQ
PASCVVFCNTKKDCQAVCDSLNAAGQSALSLHGDLEQRDRDQTLVRFANGSSRVLVATDV
AARGLDIKSLELVVNYELAWDPEVHVHRIGRTARAGESGLAISLCAPEEAQRANILAEML
QMKLNWMNGPTNSTVVPLQAEMATLCIDGGKKAKMRAGDVLGALTGDIGLDGADIGKIAV
HPAHVYVAVRQGVAHKAFKQLQNGKIKGKACRVRLLK