Protein Info for BWI76_RS12250 in Klebsiella michiganensis M5al

Annotation: terminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 PF03237: Terminase_6N" amino acids 18 to 227 (210 residues), 109.9 bits, see alignment E=1.5e-35 PF17289: Terminase_6C" amino acids 298 to 406 (109 residues), 33.8 bits, see alignment E=3.4e-12

Best Hits

KEGG orthology group: None (inferred from 96% identity to eae:EAE_21095)

Predicted SEED Role

"Putative phage terminase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (422 amino acids)

>BWI76_RS12250 terminase (Klebsiella michiganensis M5al)
MLDNNCYVTADGAIHHNSGKTWVGCGGICKGMWEHPKINQGYFAPTYPQIRDIFYPTVEE
VAYDWGLNVKINEGNKEVHFYAGKQFRGTTICRSMEKPHTIVGFKIGNALIDELDVMPAK
KAQLAWRKIIARMRYNVPGLRNGIDVTTTPEGFKFVYQQFAKAVRDKPSLSTLYGLVQAS
TFDNEKNLPADYIPSLMESYPPELIKAYLRGQFTNLTSGTIYHQFDRQLNNCQEEEQPGE
PLYIGMDFNVGKMAGIVHVLRLGLPCAVTEIIKAYDTPDIIRIIKERFWLYDGNDYRKVR
EIYIYPDASGDSRKSSNASATDIAQLKQAGFNVVVNASNPPVKDRINAMNAMFCNGNGER
RYKVNVKRCPVYTESLEQQVWGENGEPDKTADNDHPNDAGGYFIVKQFPIIKPTGKVTQL
RM