Protein Info for BWI76_RS11930 in Klebsiella michiganensis M5al

Annotation: LysR family transcriptional regulator CysB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 PF00126: HTH_1" amino acids 3 to 64 (62 residues), 52.5 bits, see alignment E=3.9e-18 PF03466: LysR_substrate" amino acids 92 to 293 (202 residues), 145.4 bits, see alignment E=1.6e-46

Best Hits

Swiss-Prot: 99% identical to CYSB_KLEPN: HTH-type transcriptional regulator CysB (cysB) from Klebsiella pneumoniae

KEGG orthology group: K13634, LysR family transcriptional regulator, cys regulon transcriptional activator (inferred from 94% identity to ecm:EcSMS35_1856)

MetaCyc: 93% identical to DNA-binding transcriptional dual regulator CysB (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Cys regulon transcriptional activator CysB" in subsystem Cysteine Biosynthesis or DNA-binding regulatory proteins, strays

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2U2 at UniProt or InterPro

Protein Sequence (324 amino acids)

>BWI76_RS11930 LysR family transcriptional regulator CysB (Klebsiella michiganensis M5al)
MKLQQLRYIVEVVNHNLNVSSTAEGLYTSQPGISKQVRMLEDELGIQIFARSGKHLTQVT
PAGQEIIRIAREVLSKVDAIKSVAGEHTWPDKGSLYVATTHTQARYALPGVIKGFIERYP
RVSLHMHQGSPTQIAEAVSKGNADFAIATEALHLYDDLVMLPCYHWNRSVVVTPEHPLAS
RESVSIEELAQYPLVTYTFGFTGRSELDTAFNRAGLTPRIVFTATDADVIKTYVRLGLGV
GVIASMAVDPVSDPDLVKLDANGIFSHSTTKIGFRRSTFLRSYMYDFIQRFAPHLTRDVV
DTAVALRSNEDIEAMFKDIKLPEK