Protein Info for BWI76_RS11915 in Klebsiella michiganensis M5al

Annotation: protease SohB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 transmembrane" amino acids 22 to 46 (25 residues), see Phobius details amino acids 204 to 221 (18 residues), see Phobius details PF08496: Peptidase_S49_N" amino acids 17 to 172 (156 residues), 189.3 bits, see alignment E=4e-60 PF01343: Peptidase_S49" amino acids 175 to 323 (149 residues), 147 bits, see alignment E=4.5e-47

Best Hits

Swiss-Prot: 81% identical to SOHB_ECOLI: Probable protease SohB (sohB) from Escherichia coli (strain K12)

KEGG orthology group: K04774, serine protease SohB [EC: 3.4.21.-] (inferred from 93% identity to kva:Kvar_3046)

Predicted SEED Role

"Possible protease sohB (EC 3.4.21.-)" (EC 3.4.21.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2U1 at UniProt or InterPro

Protein Sequence (363 amino acids)

>BWI76_RS11915 protease SohB (Klebsiella michiganensis M5al)
MYTVRQRQRFTQGENVELLAQYGLFLAKIATIVVAIAVIVAIIVNLTQRKKQRGELRVTN
LSEQYKEMKEELAASLLDGPQQKLWHKAQKKKLKQEAKAAKARAKLGTPEPDAKPRAWVL
DFKGSMDAHEVSSLREEITAVLAAAKARDQVVIRLESPGGVVHGYGLAASQLQRLRDKQI
PLTVAVDKVAASGGYMMACVANRIVSAPFAILGSIGVVAQIPNINRFLKNKDIDIELHTA
GQYKRTLTMLGENTEEGRQKFREDLNDTHRLFKDFVHRMRPELDIEQVATGEHWYGVQAL
EKGLVDAVETSDELLLGLMDKHEVISVRYQQRKKMLDRFTGSAAESADKLLLRWWQRGQK
PLM