Protein Info for BWI76_RS11740 in Klebsiella michiganensis M5al

Annotation: transcriptional regulator ChbR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 PF07883: Cupin_2" amino acids 27 to 81 (55 residues), 35.4 bits, see alignment E=1.5e-12 PF12833: HTH_18" amino acids 200 to 273 (74 residues), 71.1 bits, see alignment E=1.6e-23 PF00165: HTH_AraC" amino acids 236 to 273 (38 residues), 41.4 bits, see alignment 2.4e-14

Best Hits

Swiss-Prot: 79% identical to CHBR_ECOLI: HTH-type transcriptional regulator ChbR (chbR) from Escherichia coli (strain K12)

KEGG orthology group: K03490, AraC family transcriptional regulator, cel operon repressor (inferred from 94% identity to kpu:KP1_2266)

Predicted SEED Role

"N,N'-diacetylchitobiose-specific regulator ChbR, AraC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2N7 at UniProt or InterPro

Protein Sequence (279 amino acids)

>BWI76_RS11740 transcriptional regulator ChbR (Klebsiella michiganensis M5al)
MRQPKMMTTEISTAREQQLFNGKNFHVVIYNKTESVSGLHQHDYYEYTIVLTGRYYQVIN
GKRVLLERGDFVFIPMGSHHQSFYEFGATRILNVGISKSFFEKHYLPLLPFGLVASQVYA
VKSTFLSYIESVIASLNFRETEFDEFIELVSFYTLNRLRHYREEPTEDVIPQWLKNTVEG
MHDKLKFGEGALENMVELSGKTQEYLTRATQRYYGKTPMQMINDIRINFAKKQLEITNYS
VTDIAYESGYSSPSLFIKTFKKLTSFTPSSYRKHLTSIN