Protein Info for BWI76_RS11730 in Klebsiella michiganensis M5al

Annotation: PTS N,N'-diacetylchitobiose transporter subunit IIC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 145 to 167 (23 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details amino acids 227 to 249 (23 residues), see Phobius details amino acids 300 to 320 (21 residues), see Phobius details amino acids 337 to 385 (49 residues), see Phobius details amino acids 405 to 428 (24 residues), see Phobius details TIGR00359: PTS system, cellobiose-specific IIC component" amino acids 12 to 440 (429 residues), 543 bits, see alignment E=5.6e-167 TIGR00410: PTS system, lactose/cellobiose family IIC component" amino acids 12 to 440 (429 residues), 543 bits, see alignment E=5.6e-167 PF02378: PTS_EIIC" amino acids 30 to 363 (334 residues), 146.1 bits, see alignment E=6.7e-47

Best Hits

Swiss-Prot: 88% identical to PTQC_ECOLI: PTS system N,N'-diacetylchitobiose-specific EIIC component (chbC) from Escherichia coli (strain K12)

KEGG orthology group: K02761, PTS system, cellobiose-specific IIC component (inferred from 90% identity to ent:Ent638_1707)

MetaCyc: 88% identical to N,N'-diacetylchitobiose-specific PTS enzyme IIC component (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-155B [EC: 2.7.1.196]

Predicted SEED Role

"PTS system, N,N'-diacetylchitobiose-specific IIC component"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.196

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2Q4 at UniProt or InterPro

Protein Sequence (452 amino acids)

>BWI76_RS11730 PTS N,N'-diacetylchitobiose transporter subunit IIC (Klebsiella michiganensis M5al)
MSKVIDSLEKVLLPFAVKIGRQPHVNAIKNGFIKLMPLTLAGAMFVLINNVFLSFGDGSF
FYSMGIRLDASTIETLNGFKAIGGNVYNGTLGIMSLMAPFFIGSALAEERKVDPMAAGLL
AVAAFMTVTPYSVGEAYAVGANWLGGANIISGIVIGLVVAEMFTFIVHRNWVITLPSSVP
ASVSRSFSAVIPAFIILSIMGIISWALTHWGTNFHQIIMDTISTPLASMGAVVGWAYVIF
TSLLWFFGVHGSLALSALDSGIMTPWALENIATYQQYGSVEAALAAGKSFHMWAKPMLDS
YIFLGGTGATLGLIIAIFIASRREDHRQVAKLALPSGIFQINEPILFGLPIIMNPVMFIP
FILIQPLLAAITMTAYTLGIIPPITNIAPWTMPTGLGAFFNTNGSVAALLLALFNLAVST
LVYLPFVVISNKAQGVIEQEESEEDIANALKF