Protein Info for BWI76_RS11695 in Klebsiella michiganensis M5al

Annotation: ATP-independent periplasmic protein-refolding chaperone

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13801: Metal_resist" amino acids 35 to 135 (101 residues), 43.8 bits, see alignment E=2.8e-15 PF07813: LTXXQ" amino acids 45 to 140 (96 residues), 83.5 bits, see alignment E=1.6e-27

Best Hits

Swiss-Prot: 74% identical to SPY_ECO57: Periplasmic chaperone Spy (spy) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 85% identity to kpe:KPK_3216)

Predicted SEED Role

"Periplasmic protein related to spheroblast formation"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2F7 at UniProt or InterPro

Protein Sequence (160 amino acids)

>BWI76_RS11695 ATP-independent periplasmic protein-refolding chaperone (Klebsiella michiganensis M5al)
MKKITALFVASTLALGAANLAHAADATATPTDNAPMMHHKRGPGGPHEMMFKGLNLTEAQ
KTQIRDIMKSQRDNMKRPSLDERRAMHELVASDTFDKAKAEAQIDKMEAQHKEMALARLE
TQNKIYNILTPEQKKQFNANFEKHLTDRKAPEGKMPAPAE