Protein Info for BWI76_RS11690 in Klebsiella michiganensis M5al

Annotation: succinylglutamate desuccinylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 TIGR03242: succinylglutamate desuccinylase" amino acids 3 to 318 (316 residues), 424.3 bits, see alignment E=1.6e-131 PF24827: AstE_AspA_cat" amino acids 44 to 232 (189 residues), 186 bits, see alignment E=5.7e-59 PF04952: AstE_AspA_hybrid" amino acids 249 to 319 (71 residues), 82 bits, see alignment E=2.6e-27

Best Hits

Swiss-Prot: 66% identical to ASTE_SALPA: Succinylglutamate desuccinylase (astE) from Salmonella paratyphi A (strain ATCC 9150 / SARB42)

KEGG orthology group: None (inferred from 78% identity to eae:EAE_21585)

MetaCyc: 64% identical to succinylglutamate desuccinylase (Escherichia coli K-12 substr. MG1655)
Succinylglutamate desuccinylase. [EC: 3.5.1.96]

Predicted SEED Role

"Succinylglutamate desuccinylase (EC 3.5.1.96)" in subsystem Arginine and Ornithine Degradation (EC 3.5.1.96)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.96

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2M2 at UniProt or InterPro

Protein Sequence (321 amino acids)

>BWI76_RS11690 succinylglutamate desuccinylase (Klebsiella michiganensis M5al)
MDDFLALTLAGRLPHHFHGQTAQFRWHWIDCGILQLVPHEPCDRSLVLSSGLHGNETAPV
EITDLLLRQLFRGETPLRWRLLVIFGNPQALRANKRYLHSDINRMFGERWRAFSASDETV
RARQLEHALARFYAATAGERWHLDLHTAIRGSLHTRFGVLPAREKPWDEGFLRWLGAAGL
EALVFHQQPGGTFTHFSSERFGALSCTLELGKALPFGDNDLRLFAATQRALSLLLAGELT
LEDEHTPLRYRVVQQITRSSDRFQLHMSAQTLNFTLFSFGTLLAEDGDTRYVVEGEQEYV
LFPNPSVAFGQRAGLMLQRFQ