Protein Info for BWI76_RS11515 in Klebsiella michiganensis M5al

Annotation: peptide-methionine (R)-S-oxide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 137 TIGR00357: methionine-R-sulfoxide reductase" amino acids 4 to 135 (132 residues), 214.1 bits, see alignment E=3e-68 PF01641: SelR" amino acids 9 to 127 (119 residues), 181.2 bits, see alignment E=3.2e-58

Best Hits

Swiss-Prot: 87% identical to MSRB_ECO5E: Peptide methionine sulfoxide reductase MsrB (msrB) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: None (inferred from 90% identity to eae:EAE_21715)

MetaCyc: 87% identical to methionine sulfoxide reductase B (Escherichia coli K-12 substr. MG1655)
L-methionine (R)-S-oxide reductase. [EC: 1.8.4.14]; Peptide-methionine (R)-S-oxide reductase. [EC: 1.8.4.14, 1.8.4.12]

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12)" (EC 1.8.4.12)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.12 or 1.8.4.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2E4 at UniProt or InterPro

Protein Sequence (137 amino acids)

>BWI76_RS11515 peptide-methionine (R)-S-oxide reductase (Klebsiella michiganensis M5al)
MSNKPSSDELKKNLSEMQFYVTQNHGTEPPFTGRLLHNKRDGVYHCLVCDAALFHSQTKY
DSGCGWPSFYEPVSDDAIRYLDDYSHGMQRTEIRCGNCDAHLGHVFPDGPQPTGERFCVN
SASLSFTNDENGEQIKG