Protein Info for BWI76_RS11375 in Klebsiella michiganensis M5al

Annotation: iron-dicitrate transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 63 to 82 (20 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details amino acids 118 to 140 (23 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 178 to 195 (18 residues), see Phobius details amino acids 201 to 221 (21 residues), see Phobius details amino acids 241 to 268 (28 residues), see Phobius details amino acids 281 to 304 (24 residues), see Phobius details amino acids 310 to 328 (19 residues), see Phobius details PF01032: FecCD" amino acids 20 to 330 (311 residues), 298.4 bits, see alignment E=2.7e-93

Best Hits

Swiss-Prot: 73% identical to FECC_ECOLI: Fe(3+) dicitrate transport system permease protein FecC (fecC) from Escherichia coli (strain K12)

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 76% identity to cko:CKO_03836)

MetaCyc: 73% identical to ferric citrate ABC transporter membrane subunit FecC (Escherichia coli K-12 substr. MG1655)
ABC-9-RXN [EC: 7.2.2.18]

Predicted SEED Role

"Iron(III) dicitrate transport system permease protein FecC (TC 3.A.1.14.1)" (TC 3.A.1.14.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2D8 at UniProt or InterPro

Protein Sequence (332 amino acids)

>BWI76_RS11375 iron-dicitrate transporter permease subunit (Klebsiella michiganensis M5al)
MKLFHRARFIWGLPLLALTGLFWLSLFCYSPIPISPLNALHALLAPDTPALAEALVLNLR
LPRSLVAIMLGASLAMSGALLQTLTHNPLASPSLLGINSGAALAIALTSAFSPAPLAGFS
LALIAACGGGLSWLLVMTAGGGWRQQLDRHRLILAGIALSALCMALSRMTLLLAEDRAWG
ILTWLAGGVSHVRWAEFWQLFPFFALIAPGVFLLANALNLLNVGDTAAHSLGVNLPRLRL
LINAAVLLLTGASVSVAGPVAFIGLLVPHLARFCAGHDHRFLLPMSAVLGALLMLLADIL
ARALAWPGELPAGAVLALVGAPCFVWLVRRRG