Protein Info for BWI76_RS11360 in Klebsiella michiganensis M5al

Annotation: L-asparaginase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR00520: L-asparaginase, type II" amino acids 7 to 347 (341 residues), 445.9 bits, see alignment E=4.3e-138 PF00710: Asparaginase" amino acids 26 to 218 (193 residues), 215.1 bits, see alignment E=6.8e-68 PF17763: Asparaginase_C" amino acids 239 to 344 (106 residues), 91.3 bits, see alignment E=4.2e-30

Best Hits

Swiss-Prot: 72% identical to ASPG_DICCH: L-asparaginase (ansB) from Dickeya chrysanthemi

KEGG orthology group: K01424, L-asparaginase [EC: 3.5.1.1] (inferred from 92% identity to kpe:KPK_3321)

MetaCyc: 85% identical to N-(1-deoxy-D-fructos-1-yl)-L-asparaginase (Salmonella enterica enterica serovar Typhimurium str. LT2)
Asparaginase. [EC: 3.5.1.1]

Predicted SEED Role

"L-asparaginase (EC 3.5.1.1)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 3.5.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.1

Use Curated BLAST to search for 3.5.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2A2 at UniProt or InterPro

Protein Sequence (347 amino acids)

>BWI76_RS11360 L-asparaginase (Klebsiella michiganensis M5al)
MNFRALLAITLLTISAFAFSDTRLPHIVILATGGTIAGSAASNTQTTGYKAGAIGVQTLI
NAVPEMSKVARVDGEQVANIGSENMTSDIILKLSKRVNELLARDDVDGVVITHGTDTLDE
TPYFLNLTVKSNKPVVFTAAMRPATAISADGPMNLLEAVTVAADPQAKGRGVMVVLNDRI
GAARFVTKTNATTLDTFKAPEEGYLGVIVSGKPQFETRVDKIHTVRSVFDVRQLNALPKV
VIIYGYQDDPEYMYDAAIAHHVDGIIYAGTGAGSVSVRSAAGIEKAEKAGIVVVRASRTG
SGVVPVDDGQPGLVSDSLNPAKARILLMTALTQTKNPQVIQQYFHTY