Protein Info for BWI76_RS11275 in Klebsiella michiganensis M5al

Annotation: sensor protein PhoQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 transmembrane" amino acids 17 to 42 (26 residues), see Phobius details amino acids 194 to 217 (24 residues), see Phobius details PF08918: PhoQ_Sensor" amino acids 10 to 189 (180 residues), 292.5 bits, see alignment E=1.9e-91 PF14501: HATPase_c_5" amino acids 377 to 462 (86 residues), 22.5 bits, see alignment E=1.4e-08 PF02518: HATPase_c" amino acids 377 to 477 (101 residues), 60.8 bits, see alignment E=2.6e-20

Best Hits

Swiss-Prot: 81% identical to PHOQ_ECOLI: Sensor protein PhoQ (phoQ) from Escherichia coli (strain K12)

KEGG orthology group: K07637, two-component system, OmpR family, sensor histidine kinase PhoQ [EC: 2.7.13.3] (inferred from 90% identity to kpe:KPK_3416)

MetaCyc: 81% identical to sensor histidine kinase PhoQ (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Sensor protein PhoQ (EC 2.7.13.3)" in subsystem Lipid A modifications (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2G7 at UniProt or InterPro

Protein Sequence (488 amino acids)

>BWI76_RS11275 sensor protein PhoQ (Klebsiella michiganensis M5al)
MKGLLRHILPLSLRVRFLLATAAVVLVLSLSYGMVALVGYSVSFDKTTFRLLRGESNLFY
MLAKWENNTIEVDIPDNLNMQSPTVTLIYDAHGQLLWAQRDVPWLVKRIQPDWLKNNGFH
EIEADVDSSSMLQHNNHEIQQQLDAIREEDDGSEMTHSVAINIYPATSTMPQLSIVVVDT
IPVELKRSYMVWSWFIYVLAANLLLVIPLLWVAAWWSLRPIESLAKEVRELEEHHREMLN
PNTTRELTRLVSNLNRLLKSERERYDKYRTTLTDLTHSLKTPLAVMQSTLRSMRGEKLSV
NEAEPVMLEQISRISQQIGYYLHRASMRSGGSLLSRELHPIAPLLDSLTSALNKVYQRKG
VNITLDISPEISFVGEKNDFMEVMGNVLDNACKYCLEFVEVSVRQTNDNHLHILVEDDGP
GIPATMRSAVFDRGQRADTLRPGQGVGLSVARDIVAQYDGRILAEDSLLGGACMEVIFGR
QTLEDKES