Protein Info for BWI76_RS11130 in Klebsiella michiganensis M5al

Annotation: PTS glucose transporter subunit IIBC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 transmembrane" amino acids 16 to 39 (24 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 79 to 101 (23 residues), see Phobius details amino acids 113 to 132 (20 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details amino acids 192 to 210 (19 residues), see Phobius details amino acids 253 to 272 (20 residues), see Phobius details amino acids 278 to 297 (20 residues), see Phobius details amino acids 306 to 331 (26 residues), see Phobius details amino acids 354 to 376 (23 residues), see Phobius details TIGR02002: PTS system, glucose-specific IIBC component" amino acids 2 to 475 (474 residues), 776.6 bits, see alignment E=1.6e-237 PF02378: PTS_EIIC" amino acids 13 to 320 (308 residues), 283.4 bits, see alignment E=2.2e-88 TIGR00852: PTS system, maltose and glucose-specific subfamily, IIC component" amino acids 52 to 331 (280 residues), 300.6 bits, see alignment E=1.7e-93 TIGR00826: PTS system, glucose-like IIB component" amino acids 378 to 460 (83 residues), 85.2 bits, see alignment E=4.8e-28 PF00367: PTS_EIIB" amino acids 405 to 436 (32 residues), 53.5 bits, see alignment (E = 1.3e-18)

Best Hits

Swiss-Prot: 97% identical to PTGCB_ECOLI: PTS system glucose-specific EIICB component (ptsG) from Escherichia coli (strain K12)

KEGG orthology group: K02778, PTS system, glucose-specific IIB component [EC: 2.7.1.69] K02779, PTS system, glucose-specific IIC component (inferred from 98% identity to enc:ECL_02535)

MetaCyc: 97% identical to glucose-specific PTS enzyme IIBC component (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-157 [EC: 2.7.1.199]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.199 or 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B258 at UniProt or InterPro

Protein Sequence (477 amino acids)

>BWI76_RS11130 PTS glucose transporter subunit IIBC (Klebsiella michiganensis M5al)
MFKNAFANLQKVGKSLMLPVSVLPIAGILLGVGSANFSWLPAVVSHVMAEAGGSVFANMP
LIFAIGVALGFTNNDGVSALASVVAYGIMVKTMSVVAPLVLHLPAEEIAAKHLADTGVLG
GIISGAIAAYMFNRFYRIKLPEYLGFFAGKRFVPIISGLAAIFTGVILSFIWPPIGTAIQ
TFSQWAAYQNPVVAFGIYGFIERCLVPFGLHHIWNVPFQMQIGEYTNAAGQVFHGDIPRY
MAGDPTAGKLSGGFLFKMYGLPAAAIAIWHSAKPENRAKVGGIMISAALTSFLTGITEPI
EFSFMFVAPILYIIHAILAGLAFPICILLGMRDGTSFSHGLIDFIVLSGNSSKLWLFPIV
GICYAIVYYVVFRVLIKALDLKTPGREDATEDSKAGATSEMAPALIAAFGGKENITNLDA
CITRLRVSVADVAKVDQAGLKKLGAAGVVVAGSGVQAIFGTKSDNLKTEMDEYIRSN