Protein Info for BWI76_RS11110 in Klebsiella michiganensis M5al

Annotation: cell division protein YceG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR00247: conserved hypothetical protein, YceG family" amino acids 1 to 337 (337 residues), 485.1 bits, see alignment E=5.8e-150 PF02618: YceG" amino acids 43 to 328 (286 residues), 282.5 bits, see alignment E=1.9e-88

Best Hits

Swiss-Prot: 84% identical to MLTG_ECOLI: Endolytic murein transglycosylase (mltG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 91% identity to eae:EAE_16395)

MetaCyc: 84% identical to endolytic murein transglycosylase (Escherichia coli K-12 substr. MG1655)
4.2.2.f [EC: 4.2.2.f]

Predicted SEED Role

"FIG004453: protein YceG like"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.2.f

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2B3 at UniProt or InterPro

Protein Sequence (340 amino acids)

>BWI76_RS11110 cell division protein YceG (Klebsiella michiganensis M5al)
MKKMLRFILLLVVVLGIAAGIGMWKVRQLADSKLLIKEETIFTLATGTGRLALGQQLYSD
KVINRPRVFQWLLRIEPELSHFKAGTYRFTPDMTVRQMLQLLASGKEAQFPLRFVEGMRV
SDYLRQLRDAPYVKHTLADDSYETVAKALDLEHPDWVEGWFWPDTWMYTANTSDVAILKR
AHQKMVAAVDKAWEGRMENLPYHDKNQLLTMASIIEKETAVSDERDRVASVFINRLRIGM
RLQTDPTVIYGMGESYNGKLTRKDLETPTAYNTYVINGMPPGPIAAPGEASLNAAAHPAK
TPYLYFVADGKGGHTFNTNLASHNRSVQDYLKVLKEKNAQ