Protein Info for BWI76_RS11020 in Klebsiella michiganensis M5al

Annotation: oxidoreductase family, NAD-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 PF01408: GFO_IDH_MocA" amino acids 5 to 122 (118 residues), 101.3 bits, see alignment E=6.2e-33 PF21378: YceM-like_C" amino acids 128 to 245 (118 residues), 167.9 bits, see alignment E=1e-53

Best Hits

Swiss-Prot: 79% identical to YCEM_ECOLI: Putative oxidoreductase YceM (yceM) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 89% identity to eae:EAE_16315)

Predicted SEED Role

"Virulence factor MviM" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B289 at UniProt or InterPro

Protein Sequence (307 amino acids)

>BWI76_RS11020 oxidoreductase family, NAD-binding protein (Klebsiella michiganensis M5al)
MSAKLRIGVVGLGGIAQKAWLPVLGAADGWTLQAAWSPGKEKALRICETWRIPYADSLEQ
LAAQCDAVFVHTSTASHYEVVCRLLNAGVHVCVDKPLADKLSDAETLVELAARRHLTLMV
GFNRRFAPLYRELKAQLGNAASLRMDKHRSDSVGHDLRFTLLDDYLHVVDTALWLAGDKA
RLSGGSLHTTAQGEMLYAEHHFTSGMIQITTSMHRRAGSQREWVQAVTDGGLYEVRDMRE
WQEERGRGVIQRPIPGWQTTLEQRGFTGCARHFIECVQNQTVPETSGEQALLAQRVVDKL
WREAMSE