Protein Info for BWI76_RS10960 in Klebsiella michiganensis M5al

Annotation: lipid A biosynthesis lauroyl acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 17 to 41 (25 residues), see Phobius details amino acids 83 to 97 (15 residues), see Phobius details amino acids 126 to 143 (18 residues), see Phobius details PF03279: Lip_A_acyltrans" amino acids 5 to 297 (293 residues), 390.6 bits, see alignment E=2.2e-121 TIGR02207: lipid A biosynthesis lauroyl (or palmitoleoyl) acyltransferase" amino acids 5 to 306 (302 residues), 486.3 bits, see alignment E=1.8e-150

Best Hits

Swiss-Prot: 85% identical to LPXL_ECO57: Lipid A biosynthesis lauroyltransferase (lpxL) from Escherichia coli O157:H7

KEGG orthology group: K02517, lipid A biosynthesis lauroyl acyltransferase [EC: 2.3.1.-] (inferred from 90% identity to kpn:KPN_01068)

MetaCyc: 85% identical to lauroyl acyltransferase (Escherichia coli K-12 substr. MG1655)
LAUROYLACYLTRAN-RXN [EC: 2.3.1.241]

Predicted SEED Role

"Lipid A biosynthesis (KDO) 2-(lauroyl)-lipid IVA acyltransferase (EC 2.3.1.-)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.241

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B297 at UniProt or InterPro

Protein Sequence (306 amino acids)

>BWI76_RS10960 lipid A biosynthesis lauroyl acyltransferase (Klebsiella michiganensis M5al)
MTHLPKFSAALLHPRYWLLWFGIGLLWLVVQLPYPVIYRLGTGLGHLARRLMKRRAKIAY
RNLELCFPDKSEQERHRMVVANFESVGMGLLETGMAWFWPTKRIARWTDSIGVEHIRDVQ
AQKRGILLIGIHFLTLEMGARMFGINEPGIGVYRPNDNPVIDWLQTWGRLRSNKDMIDRK
DLKGMIRALKKGEVIWYAPDHDYGPSASVFVPFFAVDQAATTSGTWMLAKMSKACVVPFV
PRRKPDGKGYELIILPPECDPPLDDAETTAVWMNKVVEKCILMAPEQYMWMHRRFKTRPE
GIPSRY