Protein Info for BWI76_RS10935 in Klebsiella michiganensis M5al

Annotation: glucan biosynthesis glucosyltransferase H

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 842 transmembrane" amino acids 139 to 156 (18 residues), see Phobius details amino acids 190 to 217 (28 residues), see Phobius details amino acids 512 to 537 (26 residues), see Phobius details amino acids 566 to 590 (25 residues), see Phobius details amino acids 599 to 617 (19 residues), see Phobius details amino acids 623 to 640 (18 residues), see Phobius details amino acids 659 to 676 (18 residues), see Phobius details amino acids 682 to 704 (23 residues), see Phobius details PF00535: Glycos_transf_2" amino acids 246 to 428 (183 residues), 72.5 bits, see alignment E=6.1e-24 PF13506: Glyco_transf_21" amino acids 313 to 468 (156 residues), 23.1 bits, see alignment E=7.3e-09 PF13632: Glyco_trans_2_3" amino acids 342 to 544 (203 residues), 56.7 bits, see alignment E=4.7e-19

Best Hits

Swiss-Prot: 96% identical to OPGH_KLEP3: Glucans biosynthesis glucosyltransferase H (mdoH) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: None (inferred from 96% identity to eae:EAE_16240)

Predicted SEED Role

"Glucans biosynthesis glucosyltransferase H (EC 2.4.1.-)" (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B290 at UniProt or InterPro

Protein Sequence (842 amino acids)

>BWI76_RS10935 glucan biosynthesis glucosyltransferase H (Klebsiella michiganensis M5al)
MNKITKYIDALPLSDAEKSALPDASLQAVHEALDAEHHVFKREDDAPLGSVKSRLEHSWP
DSLAGNQLVKDDEGRTQLNAMPKAKRSSMFPDPWRTNPVGRFWDRLRGRDVTPRYLSRLS
KEEQESEQKWRTVGSIRRYILLLLTLAQTVVATWYMKTILPYQGWALINPADMVGQNLWV
SFMQLLPYVLQSGILILFAVLFCWVSAGFWTALMGFLQLLIGRDKYSISASTVGDEPLNP
EHRTALIMPICNEDVDRVFAGLRATWESVKASGNAEHFDVYILSDSYNPDICVAEQKAWM
ELIAEVQGEGQIFYRRRRRRVKRKSGNIDDFCRRWGSQYSYMVVLDADSVMSGECLSGLV
RLMEANPNAGIIQSSPRASGMDTLYARCQQFATRVYGPLFTAGLHFWQLGESHYWGHNAI
IRVKPFIEHCALAPLPGEGNFAGSILSHDFVEAALMRRAGWGVWIAYDLPGSYEELPPNL
LDELKRDRRWCQGNLMNFRLFLVKGMHPVHRAVFLTGVMSYLSAPLWFMFLALSTALQVV
HALTEPQYFLQPRQLFPVWPQWRPELAIALFASTMVLLFLPKLLSIILVWCKGPKEYGGF
IRVTLSLLLEVLFSVLLAPVRMLFHTVFVVSAFLGWEVVWNSPQRDDDSTPWGEAFMRHG
SQMLLGLVWAVGMAWLDLRFLFWLAPIVVSLILSPFVSAISSRATIGLRTKRWKLFLIPE
EYSPPQVLKDTDAYLTLNRQRSLEDGFMHAVFNPSFNALATAMATARHRHGHILDIARER
HVEQALNETPDKLNRDRRLVLLSDPVTMSRLHYRVWAAPEKYSSWVGAYQQLTLNPLALK
TK