Protein Info for BWI76_RS10930 in Klebsiella michiganensis M5al

Annotation: glucan biosynthesis protein G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 517 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF04349: MdoG" amino acids 29 to 512 (484 residues), 648 bits, see alignment E=5.4e-199

Best Hits

Swiss-Prot: 97% identical to OPGG_KLEP3: Glucans biosynthesis protein G (mdoG) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K03670, periplasmic glucans biosynthesis protein (inferred from 97% identity to kva:Kvar_3318)

Predicted SEED Role

"Glucans biosynthesis protein G precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B215 at UniProt or InterPro

Protein Sequence (517 amino acids)

>BWI76_RS10930 glucan biosynthesis protein G (Klebsiella michiganensis M5al)
MKHKPQMMKMRWLSAAVMLSLCTSSAWAFSIDDVAKEAQTLAGKGFEAPKSNLPSAFRDM
KYADYQQIQFNHDKAYWNNLKSPFKLEFYHQGMYFDTPVTINEVTATSVRKIKYNPDYFN
FGNVQHDKDTVKDLGFAGFKVLYPINSKDKNDEIVSMLGASYFRVLGQGQVYGLSARGLA
IDTALPSGEEFPRFREFWIERPKATDKRLTIYALLDSPRATGAYRFVIMPGRDTVVDVQS
KVYLRDKVGKLGVAPLTSMFLFGPHQPSPTTNYRPALHDSNGLSILAGNGEWIWRPLNNP
KHLAVSSYAMENPQGFGLLQRGRQFSRFEDLDDRYDLRPSAWITPKGDWGKGKIELVEIP
TNDETNDNIVTYWTPDQLPEPGKEMNFKYTITFSRDEDKLHAPDNAYVMQTRRSTGDVKQ
SNLIRQPDGTIAFIVDFTGAEMKKLPADTPVTAQASIGDNAEIVENTVRYNPVTKGWRMI
LRVKVKDPKKTTDMRAALVNTDQTLSETWSYQLPANE