Protein Info for BWI76_RS10785 in Klebsiella michiganensis M5al

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 transmembrane" amino acids 64 to 81 (18 residues), see Phobius details PF00440: TetR_N" amino acids 23 to 69 (47 residues), 46.7 bits, see alignment 2.2e-16 PF08362: TetR_C_3" amino acids 70 to 211 (142 residues), 196.3 bits, see alignment E=2.5e-62

Best Hits

Swiss-Prot: 84% identical to RUTR_ECOLI: HTH-type transcriptional regulator RutR (rutR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 92% identity to eae:EAE_16040)

Predicted SEED Role

"Transcriptional regulator RutR of pyrimidine catabolism (TetR family)" in subsystem Pyrimidine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B2B2 at UniProt or InterPro

Protein Sequence (212 amino acids)

>BWI76_RS10785 transcriptional regulator (Klebsiella michiganensis M5al)
MAQGSVKKIGKRSLAVSAKKEAILAAALDAFSQFGIHGTRLEQVAELAGVSKTNLLYYYP
SKEALYIAVLQQILAIWLAPLKAFREDISPLVAIGEYIRLKLEVSRDHPQASRLFCLEML
QGAPLLMGELTGDLKALVDEKSAIISGWVESGRLAPVDPQHLIFMIWATTQHYADFATQV
EAVTGATLRDEAFFQQTVDNVQRMIIEGIRVR