Protein Info for BWI76_RS10780 in Klebsiella michiganensis M5al

Annotation: pyrimidine utilization protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 PF00296: Bac_luciferase" amino acids 1 to 319 (319 residues), 177 bits, see alignment E=3.1e-56 TIGR03612: pyrimidine utilization protein A" amino acids 1 to 355 (355 residues), 721.5 bits, see alignment E=1.1e-221

Best Hits

Swiss-Prot: 96% identical to RUTA_KLEVT: Pyrimidine monooxygenase RutA (rutA) from Klebsiella variicola (strain At-22)

KEGG orthology group: K09018, putative monooxygenase RutA [EC: 1.14.-.-] (inferred from 96% identity to kpe:KPK_3520)

MetaCyc: 92% identical to pyrimidine monooxygenase RutA (Escherichia coli K-12 substr. MG1655)
RXN-12886 [EC: 1.14.99.46]; 1.14.99.46 [EC: 1.14.99.46]

Predicted SEED Role

"Predicted monooxygenase RutA in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.-.-

Use Curated BLAST to search for 1.14.-.- or 1.14.99.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B261 at UniProt or InterPro

Protein Sequence (363 amino acids)

>BWI76_RS10780 pyrimidine utilization protein A (Klebsiella michiganensis M5al)
MKIGVFVPIGNNGWLISTHAPQYMPTFELNKAIVQKAEHYGFDFALSMIKLRGFGGKTEF
WDHNLESFTLMAGLAAVTSRIQIYATAATLTLPPAIVARMASTIDSISGGRFGVNLVTGW
QKPEYEQMGMWPGDDYFASRYDYLTEYVQVLRDLWGTGRSDFKGDYFTMNDCRVSPQPSQ
PMKVICAGQSDAGMAFSAQHADYNFCFGKGVNTPAAFAPTAARMMQAAEKTGRDVGSYVL
FMVIADETDEAARAKWEHYKAGADDEALAWLTEQSQKDTRSGSDTNVRQMADPTSAVNIN
MGTLVGSYASVARMLDEVAAVPGTDGVLLTFDDFLIGIEAFGQRIQPLMRCRDHIATMTQ
EVA