Protein Info for BWI76_RS10755 in Klebsiella michiganensis M5al

Annotation: pyrimidine utilization flavin reductase protein F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03615: pyrimidine utilization flavin reductase protein F
  • amino acids 5 to 159 (155 residues), 271.9 bits, E=8.4e-86
• PF01613: Flavin_Reduct
  • amino acids 13 to 159 (147 residues), 133 bits, E=4.6e-43

Best Hits

Swiss-Prot: 89% identical to RUTF_KLEVT: FMN reductase (NADH) RutF (rutF) from Klebsiella variicola (strain At-22)

KEGG orthology group: K09024, putative flavin reductase RutF [EC: 1.5.1.-] (inferred from 89% identity to kva:Kvar_3346)

MetaCyc: 79% identical to FMN reductase RutF (Escherichia coli K-12 substr. MG1655)
RXN-9510 [EC: 1.5.1.42]

Predicted SEED Role

"Predicted flavin reductase RutF in novel pyrimidine catabolism pathway" in subsystem Pyrimidine utilization

MetaCyc Pathways

• bacterial bioluminescence (4/8 steps found)
• dibenzothiophene desulfurization (1/5 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Methane metabolism
• Tryptophan metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.- or 1.5.1.42

Sequence Analysis Tools

See A0A285B222 at UniProt or InterPro

Protein Sequence (164 amino acids)

>BWI76_RS10755 pyrimidine utilization flavin reductase protein F (Klebsiella michiganensis M5al)
MSIADKQSFRDAMAHVGAAVNIITTDGPAGRAGFTASAVCSVTDAPPTLLVCLNRSASVW
PIFSQHQALCVNTLAAGQEELSNVFGGKTPMAERFAAADWQTGATGCPRLEAALVSFDCR
ISQIVSVGTHDILFCEVAAIVRHPEPRGLMWFDRGYHTLMRPAC