Protein Info for BWI76_RS10710 in Klebsiella michiganensis M5al

Updated annotation (from data): Glutamate--putrescine ligase (EC 6.3.1.11)
Rationale: Specifically important for utilizing Putrescine Dihydrochloride. Automated validation from mutant phenotype: the predicted function (RXN0-3901) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: gamma-glutamylputrescine synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 94% identical to PUUA_ECOLI: Gamma-glutamylputrescine synthetase PuuA (puuA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 97% identity to eae:EAE_15935)

MetaCyc: 94% identical to glutamate-putrescine ligase (Escherichia coli K-12 substr. MG1655)
Glutamate--putrescine ligase. [EC: 6.3.1.11]

Predicted SEED Role

"Gamma-glutamyl-putrescine synthetase (EC 6.3.1.11)" (EC 6.3.1.11)

MetaCyc Pathways

superpathway of L-arginine and L-ornithine degradation (13/13 steps found)
superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (11/11 steps found)
superpathway of ornithine degradation (8/8 steps found)
putrescine degradation II (4/4 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B231 at UniProt or InterPro

Protein Sequence (472 amino acids)

>BWI76_RS10710 Glutamate--putrescine ligase (EC 6.3.1.11) (Klebsiella michiganensis M5al)
METNIVEVENFVQQSEERRVSAFTWEVKRYLERYPNTQYVDVLLTDLNGCFRGKRIPVSG
LSKLEKGCYFPASVFAMDILGNVVEEAGLGQEMGEPDRTCVPVLGTLTPSAADPEYIGQV
LLTMVDEDGAPFDVEPRNVLNRLWQQLRQRGLFPVVAVELEFYLLDRKRDAEGYLQPPCA
PGTGDRNTQSQVYSVDNLNHFADVLNEIDEIAQLQLIPADGAVAEASPGQFEINLHHTDN
VLDACDDALALKRLVRLMAEKHKMHATFMAKPYEEHAGSGMHIHISMQNNKGENVLADAD
GEDSAMLKRALAGMIDLMPASMALLAPNVNSYRRFQPGMYVPTQASWGHNNRTVALRIPC
GDRHNHRVEYRVAGADANPYLVMAAIFAGILHGLDNPLPLQEEVEGNGLEQEGLPFPIRQ
SDALWEFMQNDHLRERLGERFCHVYHACKNDELLQFERLITETEIEWMLKNA