Protein Info for BWI76_RS10705 in Klebsiella michiganensis M5al

Updated annotation (from data): Gamma-glutamyl-gamma-aminobutyrate hydrolase (EC 3.5.1.94)
Rationale: Specifically important for utilizing Putrescine Dihydrochloride. Automated validation from mutant phenotype: the predicted function (RXN0-3942) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: gamma-glutamyl-gamma-aminobutyrate hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF07722: Peptidase_C26" amino acids 8 to 224 (217 residues), 230.1 bits, see alignment E=2.8e-72 PF00117: GATase" amino acids 63 to 241 (179 residues), 46.3 bits, see alignment E=4.2e-16

Best Hits

Swiss-Prot: 88% identical to PUUD_SHISS: Gamma-glutamyl-gamma-aminobutyrate hydrolase (puuD) from Shigella sonnei (strain Ss046)

KEGG orthology group: None (inferred from 94% identity to eae:EAE_15930)

MetaCyc: 88% identical to gamma-glutamyl-gamma-aminobutyrate hydrolase (Escherichia coli K-12 substr. MG1655)
Gamma-glutamyl-gamma-aminobutyrate hydrolase. [EC: 3.5.1.94]

Predicted SEED Role

"Gamma-glutamyl-GABA hydrolase (EC 3.5.1.94)" (EC 3.5.1.94)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.94

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B212 at UniProt or InterPro

Protein Sequence (254 amino acids)

>BWI76_RS10705 Gamma-glutamyl-gamma-aminobutyrate hydrolase (EC 3.5.1.94) (Klebsiella michiganensis M5al)
MENIMYKPVIGVVMCRNRLKGHQTQTLQEKYLNAIVNAGGVPIALPHALAEPELLSALLP
KLDGIYLPGSPSNVQPHLYGENGDEPDADPGRDLLSMALIDAALERRIPIFAICRGLQEL
VVATGGTLYRRLFEQPELLEHREDPELPVEQQYAPSHEVQVQEGGLLSQLIPGCNTFWVN
SLHGQGAKTTGPRLRVEARSPDGLAEAVSVNDHPFALGVQWHPEWNSSEYALSRMLFEGF
ITACQNYVAEKQRL