Protein Info for BWI76_RS10575 in Klebsiella michiganensis M5al

Annotation: polar amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 63 to 80 (18 residues), see Phobius details amino acids 92 to 109 (18 residues), see Phobius details amino acids 147 to 170 (24 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 14 to 111 (98 residues), 90.1 bits, see alignment E=5.5e-30 PF00528: BPD_transp_1" amino acids 35 to 205 (171 residues), 70.3 bits, see alignment E=9.1e-24

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 93% identity to enc:ECL_02653)

Predicted SEED Role

"amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1U8 at UniProt or InterPro

Protein Sequence (221 amino acids)

>BWI76_RS10575 polar amino acid ABC transporter permease (Klebsiella michiganensis M5al)
MTEQLHFSELWPHWPELLAGLWVTIQLTVLATIGGLTIGIFGAAVRSGRPTWFSRIWGGY
VELIRNTPFVVQLFFIVFGLPNLGLKMTAGEAALLAMVVNLGAYSTEIVRAGIQVTPKGQ
WEAGRVLGLTRTQTFIQVILPPALQRIYPALVSQCIIVMLGSSVVSQVSYEELTFAANLI
QSRTFLSFEVYLVTTGIYLALSITMRQLLLAAGRKWLGVQA