Protein Info for BWI76_RS10490 in Klebsiella michiganensis M5al

Annotation: vanillate O-demethylase oxygenase subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 PF00355: Rieske" amino acids 26 to 105 (80 residues), 65.2 bits, see alignment E=4.1e-22 PF19112: VanA_C" amino acids 170 to 337 (168 residues), 69.1 bits, see alignment E=6e-23

Best Hits

KEGG orthology group: K03862, vanillate monooxygenase [EC: 1.14.13.82] (inferred from 90% identity to enc:ECL_02669)

Predicted SEED Role

"Vanillate O-demethylase oxygenase subunit (EC 1.14.13.82)" in subsystem Phenylpropanoid compound degradation (EC 1.14.13.82)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.82

Use Curated BLAST to search for 1.14.13.82

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B264 at UniProt or InterPro

Protein Sequence (345 amino acids)

>BWI76_RS10490 vanillate O-demethylase oxygenase subunit (Klebsiella michiganensis M5al)
MNKPQPTPPAHCTFEPEDWLRLAKCWHPVARACDIGPAPVKATLLDEQLVIYRIKGQVVV
ARDVCPHRGVPLTLGFHDEEGIVCPYHGLRFGEDGRCNRIPSSPDQPVPAKLNLTSFAVE
ERYGLIWTCLAFDPENPMPLPVMPHWHDDGFQQINCPAFEVNGFAGRQVEGFLDVAHFAW
IHTETFADPDNQVVPNYNPQETAFGFIADYWSSVGNYPASSEFRAPEGFQWLRHFEMHLP
FTATLTIHFPGEARLVIMNAASPVSSRITRMFAPIARNFDLHVPVEDVHAFNLRVFEEDR
LMVETQRPERLPLDLTLEAHIPADRSSIAYRRGLKKMGFGDFFLV