Protein Info for BWI76_RS10485 in Klebsiella michiganensis M5al

Annotation: (hypo)xanthine hydroxylase reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 PF00111: Fer2" amino acids 239 to 311 (73 residues), 49.5 bits, see alignment E=1.7e-17

Best Hits

Swiss-Prot: 43% identical to VANB_PSEUH: Vanillate O-demethylase oxidoreductase (vanB) from Pseudomonas sp. (strain HR199 / DSM 7063)

KEGG orthology group: K03863, vanillate monooxygenase [EC: 1.14.13.82] (inferred from 64% identity to kpn:KPN_01661)

MetaCyc: 43% identical to vanillate O-demethylase reductase component (Pseudomonas sp. HR199)
Vanillate monooxygenase. [EC: 1.14.13.82]

Predicted SEED Role

"Flavodoxin reductases (ferredoxin-NADPH reductases) family 1; Vanillate O-demethylase oxidoreductase (EC 1.14.13.-)" (EC 1.14.13.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-, 1.14.13.82

Use Curated BLAST to search for 1.14.13.- or 1.14.13.82

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B200 at UniProt or InterPro

Protein Sequence (322 amino acids)

>BWI76_RS10485 (hypo)xanthine hydroxylase reductase (Klebsiella michiganensis M5al)
MSDVIEVIVDGIWRQGSQNLAVRLVAQDGRPLPAWQPGAHIDVHLPCGIIRQYSLTGPDG
PDDGYLICVALEKASRGGSRYIHQQLRPGQTLLISPPRNLFPLRTAERVTLLAAGIGITP
LYAMALRLKAEGVPFTLHYYLKNRAQGAFVRELQRRFSAESVVIHCSCEGDSARQHLAAA
LNNTHTGYPIYLCGPEGFMAAARRAAMERGWADTLIHSEAFQPIAAPAGAEEGETFSVTL
ASSGERWPVPPHKTIAQVLQENGVAVPLSCEMGICGACLTPVIEGVVDHRDTVQSEAEKS
ASAQQIALCCSRSRSANLCIDL