Protein Info for BWI76_RS10475 in Klebsiella michiganensis M5al

Annotation: binding-protein-dependent transport system inner membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 524 signal peptide" amino acids 1 to 46 (46 residues), see Phobius details transmembrane" amino acids 71 to 92 (22 residues), see Phobius details amino acids 104 to 123 (20 residues), see Phobius details amino acids 130 to 151 (22 residues), see Phobius details amino acids 186 to 211 (26 residues), see Phobius details amino acids 231 to 250 (20 residues), see Phobius details amino acids 284 to 308 (25 residues), see Phobius details amino acids 328 to 350 (23 residues), see Phobius details amino acids 363 to 386 (24 residues), see Phobius details amino acids 395 to 413 (19 residues), see Phobius details amino acids 439 to 462 (24 residues), see Phobius details amino acids 495 to 516 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 95 to 248 (154 residues), 40.6 bits, see alignment E=1.1e-14 amino acids 347 to 521 (175 residues), 68.4 bits, see alignment E=3.4e-23

Best Hits

Swiss-Prot: 72% identical to FBPB_SERMA: Fe(3+)-transport system permease protein SfuB (fbpB) from Serratia marcescens

KEGG orthology group: K02011, iron(III) transport system permease protein (inferred from 86% identity to kva:Kvar_3379)

Predicted SEED Role

"Ferric iron ABC transporter, permease protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1X2 at UniProt or InterPro

Protein Sequence (524 amino acids)

>BWI76_RS10475 binding-protein-dependent transport system inner membrane protein (Klebsiella michiganensis M5al)
MSSLSFALGKKAQRLPERRRPAFPMIALAVLFSLLALLPPGFVIAVGVDTGWETIRALVF
RPRVAELLSNTLWLIALTVPLCIALGVGLAWLTERTLLAGRRLWSVLAVAPLAIPAFVQS
YAWVSAVPAMHGLSAGVFLSLLAYYPFIYMPVAAVLRRLDPTLEDVAASLGTPPWRIFFR
VVLPQLRLAICGGALLVALHLLAEFGLFAMVRFDTFTTAIYDQFQSTFSGPAANMLGGVL
ALCCLAILLLEGASRGKARYARIGSGAAREQQRQPLGRLSAIPLQLALLTLVMLALGVPL
MVLCRWLWLGGVENWMSADLWLSLRQTLLLGAVGAFLTTACAIPIAWLGVRYPQRLFRLL
EGCNYMTSSLPGIVTALALVTVTIHYARPIYQTEVTLLLAWLLMFMPRALVNLRAGIAQA
PVELENVARSLGRSPGRALWSVTMRLAAPGAAAGAALVFLGITNELTATLLLSPLGTRTL
STGFWALTSEIDYVAAAPYAMLMILLSLPLTGILYIQSKKIAGL