Protein Info for BWI76_RS10325 in Klebsiella michiganensis M5al

Annotation: AraC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 PF02311: AraC_binding" amino acids 17 to 117 (101 residues), 72.4 bits, see alignment E=4.9e-24 PF00165: HTH_AraC" amino acids 178 to 218 (41 residues), 38.4 bits, see alignment 1.5e-13 PF12833: HTH_18" amino acids 191 to 269 (79 residues), 71.8 bits, see alignment E=7.2e-24

Best Hits

KEGG orthology group: None (inferred from 80% identity to srr:SerAS9_3178)

Predicted SEED Role

"MSM (multiple sugar metabolism) operon regulatory protein" in subsystem Fructooligosaccharides(FOS) and Raffinose Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1U2 at UniProt or InterPro

Protein Sequence (279 amino acids)

>BWI76_RS10325 AraC family transcriptional regulator (Klebsiella michiganensis M5al)
MHKTFTLNHTDNIELNLYQYGEESCHKGHRYGPAVRQHYLFHYVISGTGTFYSESGAFPV
VAGEGFLIHPHDVTTYCADKKDPWHYMWLEVDGLIAARIFAECHLSRQSPIYRPNLNKDN
VSALGYLRQIVEHGDEHRLKVQGLCYLFFSTLISNTHDQRAPLRDDKTRHLQKAIKKIEN
RYHEPLSVESLAAYCNINRSYLCRLFKSAYGIGPKAYLLNFRMSIAVSLLKNSNTAIKVV
GISVGYENQLHFSKAFKKMHGVSPAKWRQKYLSEQQAAR