Protein Info for BWI76_RS10275 in Klebsiella michiganensis M5al

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 PF00005: ABC_tran" amino acids 22 to 170 (149 residues), 128.2 bits, see alignment E=5.3e-41

Best Hits

Swiss-Prot: 52% identical to GLNQ_GEOSE: Glutamine transport ATP-binding protein GlnQ (glnQ) from Geobacillus stearothermophilus

KEGG orthology group: K02028, polar amino acid transport system ATP-binding protein [EC: 3.6.3.21] (inferred from 96% identity to kpe:KPK_3288)

MetaCyc: 54% identical to L-glutamine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"ABC transporter, nucleotide binding/ATPase protein"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.21

Use Curated BLAST to search for 3.6.3.21 or 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B1T0 at UniProt or InterPro

Protein Sequence (246 amino acids)

>BWI76_RS10275 ABC transporter (Klebsiella michiganensis M5al)
MSEKPLLEMIGIDKTFGRQTVLKNCSLEVQRGETVVLIGPSGSGKSTLLRCVNMLSPADS
GDVFFASQHISRGEVPVHKLRQRIGMVFQNYELFSHLTAAENIMLAPMTVLGMNRTDART
LADNLLAKVRINERADHFPDELSGGQQQRVAIARALAMKPELMLYDEPTSALDPEMIREV
LEVMAELSAEGMTSMVVTHEMGFARRAANKILFMEDGEIIDRASTSDFFAGNVSERAQRF
LTQILH