Protein Info for BWI76_RS10230 in Klebsiella michiganensis M5al

Annotation: AAA family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 662 PF01590: GAF" amino acids 111 to 216 (106 residues), 28 bits, see alignment E=1e-09 PF00158: Sigma54_activat" amino acids 342 to 509 (168 residues), 233.5 bits, see alignment E=3.9e-73 PF14532: Sigma54_activ_2" amino acids 343 to 514 (172 residues), 70.9 bits, see alignment E=4.8e-23 PF00004: AAA" amino acids 366 to 488 (123 residues), 23.5 bits, see alignment E=2.3e-08 PF07728: AAA_5" amino acids 366 to 485 (120 residues), 29 bits, see alignment E=3.4e-10 PF25601: AAA_lid_14" amino acids 515 to 589 (75 residues), 79.2 bits, see alignment E=6.1e-26 PF02954: HTH_8" amino acids 608 to 648 (41 residues), 28 bits, see alignment 5e-10

Best Hits

KEGG orthology group: None (inferred from 87% identity to kva:Kvar_3233)

Predicted SEED Role

"Transcriptional activator of acetoin dehydrogenase operon AcoR" in subsystem Acetoin, butanediol metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (662 amino acids)

>BWI76_RS10230 AAA family ATPase (Klebsiella michiganensis M5al)
MNHNYGGVWDEEWELIARLNYEHGFAQYTDELGLAWKAFEQGQMPKGLRSAIHASWLRSH
TDGIDAYRFEYQFCEQSELRRIMAHNSLLISIARDIMRNLLAYNPDGHINLTDANGVIVH
FCGQDLTPIGSILCEAVQGTNCTGRCLKENKLVYLLSAENYKEALRLRGKHCAAAPIRDE
NGVMLGVLTLTANPGCFHYHTLGTVQAAAEAISQQLILRRLVNEQESVMESLNEGVLVIS
EQGSIRQLNCYARQVLGIQEDVRFRDADEVLRPDGCSLKELPACKDRYITLCPVADSRIS
CVISVVTTPEGGRVISMRDNRRVRDMTHRVIGSSASYNFDMILGQSRVMQDMRNKARSVG
RSDSTVLLTGESGTGKELFAQSIHNGSHRNAGPFLAVNCGAIPRDLVQSELFGYEDGAFT
GSRRGGVAGKFELADGGTLFLDEIGDMPLEAQASLLRVLQEGEVMRIGGKRPLKVNVRII
AATNRDLKKDIEHGSFRRDLYFRLNVISLPIPPLRERKEDIKELTDWFCEKVCRALGRNR
ALFSDSALKVMESYDWPGNVRELENIVERTINLTEIEEIRDKDLPEELHLPTYSDSEIPG
WSTKNYCLKDSEKTLIERCLVEKQGNLRQVAIALNLSRGALYNKLKRYGIEANEYRKLGY
DI